Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID9494 | LNELEEILDVIEP | Serine/threonine-protein phosphatase 2A 56kDa regulatory subunit gamma isoform | Serum | 763.38 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9495 | KVVNPTQK | Alpha-1-antitrypsin | Serum | 457.26 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9496 | GKVVNPTQK | Alpha-1-antitrypsin | Serum | 485.78 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9497 | MGKVVNPTQK | Alpha-1-antitrypsin | Serum | 551.29 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9498 | MGKVVNPTQK | Alpha-1-antitrypsin | Serum | 559.3 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9499 | FMGKVVNPTQK | Alpha-1-antitrypsin | Serum | 624.82 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9500 | EDPQGDAAQKTD | Alpha-1-antitrypsin | Serum | 637.76 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9501 | EDPQGDAAQKTDT | Alpha-1-antitrypsin | Serum | 688.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9502 | SPLFMGKVVNPTQ | Alpha-1-antitrypsin | Serum | 709.38 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9503 | EDPQGDAAQKTDTS | Alpha-1-antitrypsin | Serum | 731.81 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9504 | EDPQGDAAQKTDTSH | Alpha-1-antitrypsin | Serum | 533.89 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9505 | DAAQKTDTSHHDQDH | Alpha-1-antitrypsin | Serum | 569.24 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9506 | TKSPLFMGKVVNPTQK | Alpha-1-antitrypsin | Serum | 592.32 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9507 | TKSPLFMGKVVNPTQK | Alpha-1-antitrypsin | Serum | 597.65 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9508 | AVHKAVLTIDEKGTEAAGA | Alpha-1-antitrypsin | Serum | 627.67 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9509 | EDPQGDAAQKTDTSHHDQ | Alpha-1-antitrypsin | Serum | 660.6 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9510 | AVHKAVLTIDEKGTEAAGAM | Alpha-1-antitrypsin | Serum | 671.35 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9511 | AVHKAVLTIDEKGTEAAGAM | Alpha-1-antitrypsin | Serum | 676.68 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9512 | AVHKAVLTIDEKGTEAAGAMF | Alpha-1-antitrypsin | Serum | 725.71 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9513 | EDPQGDAAQKTDTSHHDQDH | Alpha-1-antitrypsin | Serum | 744.62 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9514 | KPFVFLMIEQNTKSPLFMGKVVNPTQK | Alpha-1-antitrypsin | Serum | 781.17 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9515 | SPLFMGKVVNPTQK | Alpha-1-antitrypsin | Serum | 521.27 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9516 | EDPQGDAAQKT | Alpha-1-antitrypsin | Serum | 580.25 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9517 | SPLFMGKVVNPTQK | Alpha-1-antitrypsin | Serum | 515.94 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9518 | EDPQGDAAQKTDTSHHD | Alpha-1-antitrypsin | Serum | 617.92 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9519 | NTKSPLFMGKVVNPTQK | Alpha-1-antitrypsin | Serum | 630.33 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9520 | PVELLVAES | Alpha-1B-glycoprotein | Serum | 478.75 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9521 | YESDVMGR | Alpha-2-macroglobulin | Serum | 478.7 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9522 | VGFYESDVMGR | Alpha-2-macroglobulin | Serum | 630.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9523 | VGFYESDVMGR | Alpha-2-macroglobulin | Serum | 638.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9524 | HPNSPLDEEN | Alpha-1-antichymotrypsin | Serum | 576.26 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9525 | HPNSPLDEENLTQEN | Alpha-1-antichymotrypsin | Serum | 868.87 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9526 | HPNSPLDEENLTQENQ | Alpha-1-antichymotrypsin | Serum | 932.91 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9527 | HPNSPLDEENLTQENQDR | Alpha-1-antichymotrypsin | Serum | 712.64 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9528 | HPNSPLDEENLTQENQDRGT | Alpha-1-antichymotrypsin | Serum | 765.34 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9529 | CPSLGRAEGGGV | Amiloride-sensitive cation channel 4 | Serum | 551.75 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9530 | VAPEEHPVLLTEAPLNPK | "Actin, cytoplasmic 1" | Serum | 652.01 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9531 | VAPDEHPILLTEAPLNPK | Beta-actin-like protein 2 | Serum | 652.04 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9532 | QTLPPLNN | RAC-beta serine/threonine-protein kinase | Serum | 448.73 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9533 | VAASQAALGL | Serum albumin | Serum | 450.75 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9534 | LVAASQAALGL | Serum albumin | Serum | 507.29 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9535 | KLVAASQAALG | Serum albumin | Serum | 514.81 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9536 | KLVAASQAALGL | Serum albumin | Serum | 571.33 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9537 | DAHKSEVAHR | Serum albumin | Serum | 575.27 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9538 | KKLVAASQAALG | Serum albumin | Serum | 578.83 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9539 | GKKLVAASQAALG | Serum albumin | Serum | 607.36 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9540 | KKLVAASQAALGL | Serum albumin | Serum | 635.38 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9541 | KVPQVSTPTLVEVSR | Serum albumin | Serum | 547.31 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9542 | FAEEGKKLVAASQAALGL | Serum albumin | Serum | 601.66 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9543 | DAHKSEVAHRFK | Serum albumin | Serum | 475.58 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9544 | GDEELLRFSN | Protein AMBP | Serum | 590.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9545 | GVPGDGDEELLRFSN | Protein AMBP | Serum | 802.88 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9546 | SEDFGVNEDLADSDAR | Annexin A1 | Serum | 870.37 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9547 | SALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 508.93 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9548 | VSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 657.68 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9549 | ATEHLSTLSEKAKPALEDL | Apolipoprotein A-I | Serum | 685.03 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9550 | AELQEGARQKLHELQEKLSPLGEEMRD | Apolipoprotein A-I | Serum | 784.41 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9551 | AELQEGARQKLHELQEKLSPLGEEMRDRA | Apolipoprotein A-I | Serum | 841.19 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9552 | EEYTKKLNTQ | Apolipoprotein A-I | Serum | 627.34 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9553 | VSFLSALEEYTKKLNT | Apolipoprotein A-I | Serum | 615 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9554 | HLDQQVEEF | Apolipoprotein A-IV | Serum | 572.77 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9555 | GGHLDQQVEEF | Apolipoprotein A-IV | Serum | 629.77 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9556 | ELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 750.85 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9557 | AELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 786.35 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9558 | SLAPYAQDTQEKLN | Apolipoprotein A-IV | Serum | 789.39 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9559 | SLAELGGHLDQQVEE | Apolipoprotein A-IV | Serum | 812.89 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9560 | LAELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 842.91 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9561 | SLAELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 886.42 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9562 | EELKARISASAEELRQ | Apolipoprotein A-IV | Serum | 610.66 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9563 | GNTEGLQKSLAELGGHLD | Apolipoprotein A-IV | Serum | 613.65 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9564 | SLAPYAQDTQEKLNHQ | Apolipoprotein A-IV | Serum | 614.97 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9565 | AEELKARISASAEELRQ | Apolipoprotein A-IV | Serum | 634.32 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9566 | SLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 643.32 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9567 | NAEELKARISASAEELRQ | Apolipoprotein A-IV | Serum | 672.34 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9568 | QMKKNAEELKARISASAEELRQ | Apolipoprotein A-IV | Serum | 633.34 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9569 | GNTEGLQKSLAELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 867.1 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9570 | GNTEGLQKSLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 689.6 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9571 | LAPLAEDVRGNL | Apolipoprotein A-IV | Serum | 634.35 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9572 | GNTEGLQKSLAELGGHLDQQVEEFRR | Apolipoprotein A-IV | Serum | 728.62 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9573 | TPDVSSALDKLKEFGN | Apolipoprotein C-I | Serum | 574.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9574 | TDQVLSVLKGEE | Apolipoprotein C-II | Serum | 659.35 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9575 | KDALSSVQESQVAQQA | Apolipoprotein C-III | Serum | 844.92 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9576 | TAKDALSSVQESQVAQQA | Apolipoprotein C-III | Serum | 620.98 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9577 | HATKTAKDALSSVQESQVAQQA | Apolipoprotein C-III | Serum | 766.73 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9578 | VGSLAGQPLQERA | Apolipoprotein E | Serum | 663.36 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9579 | TVGSLAGQPLQER | Apolipoprotein E | Serum | 678.36 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9580 | TVGSLAGQPLQERA | Apolipoprotein E | Serum | 713.86 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9581 | KVEQAVETEPEPEL | Apolipoprotein E | Serum | 799.37 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9582 | TVGSLAGQPLQERAQA | Apolipoprotein E | Serum | 813.41 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9583 | TVGSLAGQPLQERAQAWGE | Apolipoprotein E | Serum | 999.51 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9584 | KVEQAVETEPEPELRQQ | Apolipoprotein E | Serum | 670.66 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9585 | TVGSLAGQPLQERAQAWGERL | Apolipoprotein E | Serum | 756.38 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9586 | AATVGSLAGQPLQERAQAWGERL | Apolipoprotein E | Serum | 803.76 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9587 | SYDLDPGAGSLEI | Apolipoprotein F | Serum | 668.81 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9588 | DLDPGAGSLEI | Apolipoprotein F | Serum | 543.76 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9589 | TEPISAESGEQVER | Apolipoprotein L1 | Serum | 766.36 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9590 | EEAGARVQQNVPSGTDTGDPQSKPLG | Apolipoprotein L1 | Serum | 880.07 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9591 | TVKQKPSGSEMEKK | BEN domain-containing protein 7 | Serum | 796.93 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9592 | NDDDEEEAARE | Caldesmon | Serum | 646.73 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9593 | TALELEEA | Uncharacterized protein C2orf27 | Serum | 438.2 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9594 | EARLVESN | Coiled-coil domain-containing protein 11 | Serum | 459.23 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9595 | GEGGSAPALGP | Putative uncharacterized protein C14orf181 | Serum | 456.72 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9596 | TPWSLARPQG | Complement factor B | Serum | 556.79 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9597 | IHWESASLL | Complement C3 | Serum | 528.26 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9598 | LDVSLQLPSR | Complement C3 | Serum | 564.34 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9599 | IHWESASLLR | Complement C3 | Serum | 404.55 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9600 | RIHWESASLLR | Complement C3 | Serum | 456.58 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9601 | TKENEGFTVTAEG | Complement C3 | Serum | 691.82 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9602 | EETKENEGFTVTAEG | Complement C3 | Serum | 820.86 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9603 | SEETKENEGFTVTAEG | Complement C3 | Serum | 864.35 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9604 | EETKENEGFTVTAEGK | Complement C3 | Serum | 590.26 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9605 | SEETKENEGFTVTAEGK | Complement C3 | Serum | 619.27 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9606 | HWESASLL | Complement C3 | Serum | 471.73 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9607 | SKITHRIHWESASLLR | Complement C3 | Serum | 484.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9608 | SSKITHRIHWESASLLR | Complement C3 | Serum | 506.03 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9609 | SVQLTEK | Complement C3 | Serum | 402.71 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9610 | GFKSHALQLNNRQ | Complement C4-A | Serum | 504.93 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9611 | GFKSHALQLNNRQI | Complement C4-A | Serum | 542.63 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9612 | NGFKSHALQLNNRQ | Complement C4-A | Serum | 542.95 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9613 | HALQLNN | Complement C4-A | Serum | 405.2 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9614 | SHALQLNN | Complement C4-A | Serum | 448.72 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9615 | EEELQFSLGS | Complement C4-A | Serum | 569.76 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9616 | NGFKSHALQLNNR | Complement C4-A | Serum | 500.27 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9617 | GLEEELQFS | Complement C4-B | Serum | 526.24 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9618 | GLEEELQFSLGSK | Complement C4-B | Serum | 718.84 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9619 | EEELQFSLGSKIN | Complement C4-B | Serum | 747.35 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9620 | EEELQFSLGSKINV | Complement C4-B | Serum | 796.89 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9621 | GLEEELQFSLGSKIN | Complement C4-B | Serum | 832.4 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9622 | NGFKSHALQLNNRQI | Complement C4-B | Serum | 580.64 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9623 | GLEEELQFSLGSKINV | Complement C4-B | Serum | 881.97 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9624 | PDAPLQPVTPLQLFEGR | Complement C4-B | Serum | 626.67 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9625 | GLEEELQFSLGSKINVK | Complement C4-B | Serum | 630.99 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9626 | DDPDAPLQPVTPLQLFEGR | Complement C4-B | Serum | 703.36 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9627 | GLEEELQFSLGSKINVKVGGNS | Complement C4-B | Serum | 769.05 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9628 | SQTSQAVTGGHTQIQAGSHTETVEQDR | Cornulin | Serum | 714.09 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9629 | DLMVPLGP | Cullin-9 | Serum | 421.2 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9630 | QNTAIREEL | Cytospin-A | Serum | 537.26 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9631 | VGSLPGTNPA | Chromosome transmission fidelity protein 8 homolog isoform 2 | Serum | 456.72 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9632 | EGGFTATGQR | Extracellular matrix protein 1 | Serum | 512.24 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9633 | CLMPAVQNW | HERV-K_3q21.2 provirus ancestral Env polyprotein | Serum | 531.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9634 | LAFLPESFDGDPAS | Receptor tyrosine-protein kinase erbB-2 | Serum | 733.34 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9635 | DLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 711.9 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9636 | NNSNAAEDDLPTVE | Coagulation factor XIII A chain | Serum | 744.81 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9637 | DDLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 769.41 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9638 | EDDLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 833.93 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9639 | AEDDLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 869.45 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9640 | NAAEDDLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 641.65 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9641 | NNSNAAEDDLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 746.68 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9642 | VPPNNSNAAEDDLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 844.41 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9643 | AVPPNNSNAAEDDLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 868.08 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9644 | RAVPPNNSNAAEDDLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 920.12 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9645 | TAFGGRRAVPPNNSNAAEDDLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 837.66 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9646 | TVVQPSVGAAA | Alpha-2-HS-glycoprotein | Serum | 500.27 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9647 | SGEVSHPRKT | Alpha-2-HS-glycoprotein | Serum | 549.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9648 | HTFMGVVSLGSPSGEVSHPRKT | Alpha-2-HS-glycoprotein | Serum | 578.3 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9649 | HTFMGVVSLGSPSGEVSHPRKT | Alpha-2-HS-glycoprotein | Serum | 582.3 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9650 | SPSGEVSHPR | Alpha-2-HS-glycoprotein | Serum | 526.76 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9651 | TVVQPSVGAAAG | Alpha-2-HS-glycoprotein | Serum | 528.78 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9652 | GVVSLGSPSGEVSHPRKT | Alpha-2-HS-glycoprotein | Serum | 598.65 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9653 | DFLAEGGGV | Fibrinogen alpha chain | Serum | 432.69 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9654 | GDSTFESKS | Fibrinogen alpha chain | Serum | 479.21 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9655 | DFLAEGGGVR | Fibrinogen alpha chain | Serum | 510.74 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9656 | EGDFLAEGGGV | Fibrinogen alpha chain | Serum | 525.73 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9657 | GDFLAEGGGVR | Fibrinogen alpha chain | Serum | 539.25 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9658 | TSSTSYNRGD | Fibrinogen alpha chain | Serum | 544.23 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9659 | GEGDFLAEGGGV | Fibrinogen alpha chain | Serum | 554.24 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9660 | GDSTFESKSY | Fibrinogen alpha chain | Serum | 560.73 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9661 | SGEGDFLAEGGGV | Fibrinogen alpha chain | Serum | 597.75 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9662 | EGDFLAEGGGVR | Fibrinogen alpha chain | Serum | 603.77 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9663 | DEAGSEADHEGT | Fibrinogen alpha chain | Serum | 609.23 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9664 | GSEADHEGTHST | Fibrinogen alpha chain | Serum | 614.24 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9665 | GEGDFLAEGGGVR | Fibrinogen alpha chain | Serum | 632.28 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9666 | AGSEADHEGTHST | Fibrinogen alpha chain | Serum | 649.75 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9667 | DSGEGDFLAEGGGV | Fibrinogen alpha chain | Serum | 655.26 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9668 | SGEGDFLAEGGGVR | Fibrinogen alpha chain | Serum | 675.79 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9669 | DEAGSEADHEGTH | Fibrinogen alpha chain | Serum | 452.17 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9670 | ADSGEGDFLAEGGGV | Fibrinogen alpha chain | Serum | 690.78 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9671 | TGKEKVTSGSTTTT | Fibrinogen alpha chain | Serum | 699.35 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9672 | FTSSTSYNRGDST | Fibrinogen alpha chain | Serum | 711.81 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9673 | EAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 714.29 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9674 | DSGEGDFLAEGGGVR | Fibrinogen alpha chain | Serum | 733.31 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9675 | SYSKQFTSSTSYN | Fibrinogen alpha chain | Serum | 750.34 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9676 | ADSGEGDFLAEGGGVR | Fibrinogen alpha chain | Serum | 768.83 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9677 | DEAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 514.86 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9678 | TGKEKVTSGSTTTTR | Fibrinogen alpha chain | Serum | 518.6 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9679 | ADEAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 538.54 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9680 | DEAGSEADHEGTHSTK | Fibrinogen alpha chain | Serum | 557.57 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9681 | MADEAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 582.23 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9682 | MADEAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 587.56 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9683 | DEAGSEADHEGTHSTKR | Fibrinogen alpha chain | Serum | 609.6 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9684 | AGSEADHEGTHSTKRGHA | Fibrinogen alpha chain | Serum | 616.62 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9685 | KMADEAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 624.91 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9686 | MADEAGSEADHEGTHSTK | Fibrinogen alpha chain | Serum | 624.93 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9687 | DEAGSEADHEGTHSTKRG | Fibrinogen alpha chain | Serum | 628.59 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9688 | KMADEAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 630.26 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9689 | ADEAGSEADHEGTHSTKRG | Fibrinogen alpha chain | Serum | 652.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9690 | SSSYSKQFTSSTSYNRGD | Fibrinogen alpha chain | Serum | 667.97 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9691 | DEAGSEADHEGTHSTKRGH | Fibrinogen alpha chain | Serum | 674.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9692 | DEAGSEADHEGTHSTKRGHA | Fibrinogen alpha chain | Serum | 697.96 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9693 | SSYSKQFTSSTSYNRGDST | Fibrinogen alpha chain | Serum | 701.65 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9694 | SYKMADEAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 708.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9695 | SYKMADEAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 713.6 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9696 | ADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha chain | Serum | 721.63 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9697 | SSSYSKQFTSSTSYNRGDST | Fibrinogen alpha chain | Serum | 730.66 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9698 | MADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha chain | Serum | 574.25 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9699 | MADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha chain | Serum | 770.65 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9700 | SYKMADEAGSEADHEGTHSTKR | Fibrinogen alpha chain | Serum | 602.52 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9701 | KMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha chain | Serum | 606.26 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9702 | KMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha chain | Serum | 610.27 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9703 | SYKMADEAGSEADHEGTHSTKRG | Fibrinogen alpha chain | Serum | 616.77 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9704 | ESKSYKMADEAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 617.51 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9705 | SYKMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha chain | Serum | 668.78 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9706 | SYKMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha chain | Serum | 672.78 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9707 | GDSTFESKSYKMADEAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 744.3 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9708 | KMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 748.1 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9709 | GDSTFESKSYKMADEAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 748.3 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9710 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 810.62 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9711 | NRGDSTFESKSYKMADEAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 811.9 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9712 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 814.61 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9713 | SETESRGSESGIFTNTKESSSHHPGIAEFPSRG | Fibrinogen alpha chain | Serum | 877.17 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9714 | GDSTFESK | Fibrinogen alpha chain | Serum | 435.69 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9715 | FLAEGGGVR | Fibrinogen alpha chain | Serum | 453.25 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9716 | GDFLAEGGGV | Fibrinogen alpha chain | Serum | 461.21 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9717 | DSTFESKSY | Fibrinogen alpha chain | Serum | 532.24 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9718 | SSSYSKQFTS | Fibrinogen alpha chain | Serum | 561.25 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9719 | TSSTSYNRGDST | Fibrinogen alpha chain | Serum | 638.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9720 | DEAAFFDTASTGK | Fibrinogen alpha chain | Serum | 680.32 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9721 | QFTSSTSYNRGDST | Fibrinogen alpha chain | Serum | 775.83 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9722 | STSYNRGDSTFESKS | Fibrinogen alpha chain | Serum | 555.91 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9723 | NRGDSTFESKSYKMA | Fibrinogen alpha chain | Serum | 574.26 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9724 | FTSSTSYNRGDSTFES | Fibrinogen alpha chain | Serum | 893.38 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9725 | SSSYSKQFTSSTSYNRGDSTF | Fibrinogen alpha chain | Serum | 779.69 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9726 | FTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha chain | Serum | 606.54 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9727 | YKMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha chain | Serum | 647.04 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9728 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha chain | Serum | 798.36 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9729 | SSSYSKQF | Fibrinogen alpha chain | Serum | 467.22 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9730 | KEKVTSGSTTTT | Fibrinogen alpha chain | Serum | 620.33 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9731 | SKQFTSSTSYN | Fibrinogen alpha chain | Serum | 625.3 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9732 | NRGDSTFESKSY | Fibrinogen alpha chain | Serum | 464.2 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9733 | DSHSLTTNIMEIL | Fibrinogen alpha chain | Serum | 737.37 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9734 | SSYSKQFTSSTSYN | Fibrinogen alpha chain | Serum | 793.85 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9735 | DSHSLTTNIMEILR | Fibrinogen alpha chain | Serum | 543.96 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9736 | TSSTSYNRGDSTFES | Fibrinogen alpha chain | Serum | 819.86 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9737 | NRGDSTFESKSYKM | Fibrinogen alpha chain | Serum | 550.6 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9738 | NRGDSTFESKSYKM | Fibrinogen alpha chain | Serum | 555.92 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9739 | SSSYSKQFTSSTSYN | Fibrinogen alpha chain | Serum | 837.36 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9740 | NRGDSTFESKSYKMA | Fibrinogen alpha chain | Serum | 579.6 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9741 | HRHPDEAAFFDTASTG | Fibrinogen alpha chain | Serum | 586.92 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9742 | GSEADHEGTHSTKRGHA | Fibrinogen alpha chain | Serum | 592.93 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9743 | SSSYSKQFTSSTSYNR | Fibrinogen alpha chain | Serum | 610.61 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9744 | NRGDSTFESKSYKMAD | Fibrinogen alpha chain | Serum | 612.6 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9745 | HRHPDEAAFFDTASTGK | Fibrinogen alpha chain | Serum | 629.62 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9746 | MADEAGSEADHEGTHSTK | Fibrinogen alpha chain | Serum | 630.26 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9747 | QFTSSTSYNRGDSTFES | Fibrinogen alpha chain | Serum | 957.41 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9748 | SYKMADEAGSEADHEGTH | Fibrinogen alpha chain | Serum | 645.59 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9749 | SYKMADEAGSEADHEGTH | Fibrinogen alpha chain | Serum | 650.93 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9750 | EAGSEADHEGTHSTKRGHA | Fibrinogen alpha chain | Serum | 659.63 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9751 | SYKMADEAGSEADHEGTHS | Fibrinogen alpha chain | Serum | 674.62 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9752 | MADEAGSEADHEGTHSTKR | Fibrinogen alpha chain | Serum | 676.95 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9753 | YKMADEAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 679.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9754 | MADEAGSEADHEGTHSTKR | Fibrinogen alpha chain | Serum | 682.29 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9755 | SYKMADEAGSEADHEGTHSTK | Fibrinogen alpha chain | Serum | 563.5 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9756 | SYKMADEAGSEADHEGTHSTK | Fibrinogen alpha chain | Serum | 567.5 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9757 | SYKMADEAGSEADHEGTHSTKR | Fibrinogen alpha chain | Serum | 606.52 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9758 | SYKMADEAGSEADHEGTHSTKRG | Fibrinogen alpha chain | Serum | 620.77 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9759 | ESKSYKMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha chain | Serum | 754.84 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9760 | ESKSYKMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha chain | Serum | 758.86 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9761 | NRGDSTFESKSYKMADEAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 815.87 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9762 | YNRGDSTFESKSYKMADEAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 852.64 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9763 | GDSTFESKSYKMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha chain | Serum | 881.7 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9764 | EEAPSLRPAPPPISGGGY | Fibrinogen beta chain | Serum | 897.92 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9765 | NEEGFFSA | Fibrinogen beta chain | Serum | 450.68 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9766 | NDNEEGFFSA | Fibrinogen beta chain | Serum | 565.21 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9767 | KVVPNNDK | Filamin-C | Serum | 457.27 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9768 | ESPASPSE | Fos-related antigen 2 | Serum | 402.18 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9769 | ATASRGASQAGAPQGRVPEARPN | Gelsolin | Serum | 563.04 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9770 | TASRGASQAGAPQGR | Gelsolin | Serum | 472.23 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9771 | STLVTER | ARF GTPase-activating protein GIT1 | Serum | 403.22 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9772 | PEPAKSAPAPK | Histone H2B type 1-C/E/F/G/I | Serum | 546.8 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9773 | ALAHKYH | Hemoglobin subunit beta | Serum | 420.22 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9774 | LGGHLDAK | Haptoglobin | Serum | 405.72 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9775 | VDSGNDVTDIADD | Haptoglobin | Serum | 668.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9776 | VDSGNDVTDIADDG | Haptoglobin | Serum | 696.79 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9777 | VDSGNDVTDIAD | Haptoglobin | Serum | 610.76 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9778 | SIQDWVQKTIAEN | Haptoglobin | Serum | 766.41 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9779 | LGGHLDAKG | Haptoglobin-related protein | Serum | 434.22 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9780 | ILGGHLDAK | Haptoglobin-related protein | Serum | 462.26 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9781 | ILGGHLDAKG | Haptoglobin-related protein | Serum | 490.76 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9782 | KPKNPANPVQ | Haptoglobin-related protein | Serum | 546.8 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9783 | GKPKNPANPVQ | Haptoglobin-related protein | Serum | 575.32 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9784 | EVQLLESGGGLVQPG | Ig heavy chain V-III region VH26 | Serum | 741.89 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9785 | EVQLLESGGGLVQPGG | Ig heavy chain V-III region VH26 | Serum | 770.4 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9786 | EVQLVESG | Ig heavy chain V-III region BRO | Serum | 430.72 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9787 | EVQLVESGGGLVQ | Ig heavy chain V-III region BRO | Serum | 657.85 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9788 | EVQLVESGGGLVQPG | Ig heavy chain V-III region BRO | Serum | 734.86 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9789 | EVQLVESGGGLVQPGG | Ig heavy chain V-III region BRO | Serum | 763.38 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9790 | EVQLVESGG | Ig heavy chain V-III region BRO | Serum | 459.23 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9791 | QVELVESGGGVVEPGRSLRL | Ig heavy chain V-III region CAM | Serum | 1041.04 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9792 | QVKLVQAGGGVVQPGR | Ig heavy chain V-III region HIL | Serum | 796.92 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9793 | YTQKSLSLSPG | Ig gamma-1 chain C region | Serum | 590.83 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9794 | LHNHYTQKSLSLSPG | Ig gamma-1 chain C region | Serum | 561.29 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9795 | TQKSLSLSPG | Ig gamma-2 chain C region | Serum | 509.27 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9796 | ALHNHYTQKSLSLSPG | Ig gamma-2 chain C region | Serum | 584.97 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9797 | TSKEEDDSENGV | Inward rectifier potassium channel 2 | Serum | 655.27 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9798 | PGPPDVPDH | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 465.7 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9799 | PGVLSSRQL | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 478.77 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9800 | PGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 501.23 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9801 | LPGPPDVPDH | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 522.25 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9802 | GLPGPPDVPDH | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 550.75 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9803 | LPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 557.77 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9804 | GSEMVVAGKLQ | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 567.79 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9805 | GLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 586.27 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9806 | GLPGPPDVPDHAA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 621.81 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9807 | GLPGPPDVPDHAAY | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 703.34 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9808 | GVLSSRQLGLPGPPD | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 746.88 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9809 | AVEEVTQNNFRLL | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 766.9 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9810 | PGVLSSRQLGLPGPPD | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 795.43 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9811 | PGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 808.85 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9812 | SRQLGLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 552.62 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9813 | GVLSSRQLGLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 671.34 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9814 | PGVLSSRQLGLPGPPDVPDHAA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 727.39 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9815 | PGVLSSRQLGLPGPPDVPDHAAYHP | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 645.07 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9816 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 681.83 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9817 | SEMVVAGKLQ | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 531.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9818 | GSEMVVAGKLQ | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 559.79 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9819 | IPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 410.23 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9820 | GSEMVVAGKLQDR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 463.91 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9821 | GSEMVVAGKLQDR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 469.24 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9822 | RNVSTGDVNVE | "Keratin, type I cytoskeletal 10" | Serum | 595.3 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9823 | EVFTSSSSSSSR | "Keratin, type I cytoskeletal 16" | Serum | 630.78 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9824 | SRSGGGGGGGLGSGGSIRSSY | "Keratin, type I cytoskeletal 9" | Serum | 604.96 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9825 | STATVVASSAPGV | Basic helix-loop-helix domain-containing protein KIAA2018 | Serum | 573.8 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9826 | GPGGYPGGIH | "Keratin, type II cytoskeletal 2 epidermal" | Serum | 456.23 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9827 | SRHGGGGGGFGGGGFGSRSL | "Keratin, type II cytoskeletal 2 epidermal" | Serum | 588.63 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9828 | GGSGGGGGGSSGGRGSGGGSSGGSIGGR | "Keratin, type II cytoskeletal 1" | Serum | 693.97 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9829 | SFSTASAITPSVSR | "Keratin, type II cytoskeletal 5" | Serum | 705.86 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9830 | SGFSSVSVSR | "Keratin, type II cytoskeletal 6A" | Serum | 506.75 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9831 | AIGGGLSSVGGGSSTIKY | "Keratin, type II cytoskeletal 6A" | Serum | 805.92 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9832 | AIGGGLSSVGGGSSTIKYTTTSSSSR | "Keratin, type II cytoskeletal 6A" | Serum | 806.74 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9833 | SGFSSISVSR | "Keratin, type II cytoskeletal 6C" | Serum | 513.75 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9834 | EATAKAVLEPI | KLRAQ motif-containing protein 1 | Serum | 571.35 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9835 | DDDLEHQ | Kininogen-1 | Serum | 436.16 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9836 | DDDLEHQGGH | Kininogen-1 | Serum | 561.72 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9837 | DDDLEHQGGHVLDH | Kininogen-1 | Serum | 529.56 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9838 | KHNLGHGHKHERDQGHGHQ | Kininogen-1 | Serum | 737.02 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9839 | DIQMTQSPSSLSA | Ig kappa chain V-I region AG | Serum | 690.8 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9840 | DIQMTQSPSSLSASVGNRVTIT | Ig kappa chain V-I region OU | Serum | 764.73 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9841 | EIVLTQSPGTLSL | Ig kappa chain V-III region SIE | Serum | 679.39 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9842 | DIVMTQSPDSLAVSLGERATIN | Ig kappa chain V-IV region (Fragment) | Serum | 773.08 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9843 | ELDKWAKI | Kynureninase | Serum | 501.75 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9844 | STVEKTVAPTECS | Ig lambda chain C regions | Serum | 676.32 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9845 | FLLSLVLT | Limbin | Serum | 453.26 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9846 | MGIAGLVLVVLG | Leukocyte immunoglobulin-like receptor subfamily A member 1 | Serum | 571.35 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9847 | DGVNTVTVPG | MACRO domain-containing protein 2 | Serum | 479.76 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9848 | AINGSGNAENR | "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3" | Serum | 551.76 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9849 | ERQEAEEAKEALLQ | Moesin | Serum | 548.61 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9850 | PVTVTRTTITTTT | Myeloid-associated differentiation marker | Serum | 696.38 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9851 | NSRSAVVEL | Nucleus accumbens-associated protein 1 | Serum | 487.77 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9852 | GGPGGAGVARGGAGGGP | Neurogranin | Serum | 626.31 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9853 | KGPGPGGPGGAGVARGGAGGGP | Neurogranin | Serum | 563.31 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9854 | MFLSDNPN | Niemann-Pick C1 protein | Serum | 477.18 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9855 | KEQENRKGL | Protein DJ-1 | Serum | 551.3 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9856 | EILESEEKGDPNKPSGF | PDZ and LIM domain protein 1 | Serum | 625.96 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9857 | VSSGATALRN | Plakophilin-4 | Serum | 488.24 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9858 | ICCIAEVLIT | PMS1 protein homolog 1 | Serum | 539.25 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9859 | FLPLGLALGL | Prostasin | Serum | 507.29 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9860 | DTNRASVGQDSPEPR | Plexin domain-containing protein 2 | Serum | 543.59 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9861 | DIQGQQSLRL | Ras association domain-containing protein 8 | Serum | 579.29 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9862 | EMAEDPLT | Rho-related BTB domain-containing protein 2 | Serum | 453.23 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9863 | EAFTVPLIPLGL | Putative rhophilin-2-like protein | Serum | 635.38 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9864 | FGHGAEDSLADQA | Serum amyloid A protein | Serum | 659.32 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9865 | FGHGAEDSLADQAANEWG | Serum amyloid A protein | Serum | 937.88 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9866 | EGEIAEEAAEKA | Serum deprivation-response protein | Serum | 623.77 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9867 | EGEIAEEAAEKAT | Serum deprivation-response protein | Serum | 674.29 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9868 | VEGEIAEEAAEKAT | Serum deprivation-response protein | Serum | 723.83 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9869 | LVEGEIAEEAAEKAT | Serum deprivation-response protein | Serum | 780.37 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9870 | SALVEGEIAEEAAEKAT | Serum deprivation-response protein | Serum | 573.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9871 | VEGEIAEEAAEKA | Serum deprivation-response protein | Serum | 673.34 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9872 | VEGEIAEEAAEKATS | Serum deprivation-response protein | Serum | 767.38 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9873 | AENETKSEDLPSSE | Serum deprivation-response protein | Serum | 768.34 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9874 | GAVEGKEELPDENKSLE | Serum deprivation-response protein | Serum | 615.3 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9875 | DRNLPSDSQDLGQHG | Serglycin | Serum | 546.91 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9876 | SLDRNLPSDSQDLGQHG | Serglycin | Serum | 613.61 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9877 | NLPSDSQDLGQHGLEED | Serglycin | Serum | 927.38 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9878 | SLDRNLPSDSQDLGQHGLEED | Serglycin | Serum | 775.68 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9879 | SLDRNLPSDSQDLGQHGLEEDFM | Serglycin | Serum | 873.71 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9880 | SLDRNLPSDSQDLGQHGLEEDFM | Serglycin | Serum | 868.4 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9881 | TSIEMAEG | Serine/threonine-protein kinase 3 | Serum | 419.17 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9882 | SDNQLQEGKNVIGLQ | Transgelin-2 | Serum | 821.91 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9883 | TVVPGGDLAKVQ | Tubulin alpha-4A chain | Serum | 592.34 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9884 | DLEPTVIDEIR | Tubulin alpha-4A chain | Serum | 650.35 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9885 | DGALNVDLTEFQTN | Tubulin alpha-4A chain | Serum | 768.86 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9886 | VLEEDEEVTEEAEMEPEDKGH | Tubulin beta-1 chain | Serum | 815.37 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9887 | EEDEEVTEEAEMEPEDKGH | Tubulin beta-1 chain | Serum | 744.64 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9888 | SVVPSPKVSDTVVEPYNATLSVH | Tubulin beta-4 chain | Serum | 809.11 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9889 | SLEDKTERE | Prothrombin | Serum | 553.77 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9890 | FEKKSLEDKTERE | Prothrombin | Serum | 546.94 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9891 | EETGDGLDEDSDRAIEG | Prothrombin | Serum | 904.37 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9892 | EDKTERELLESYIDGR | Prothrombin | Serum | 651.66 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9893 | SLEDKTERELLESYIDGR | Prothrombin | Serum | 718.35 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9894 | TATSEYQTFFNPR | Prothrombin | Serum | 781.36 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9895 | DKTERELLESYIDGR | Prothrombin | Serum | 608.65 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9896 | GLDEDSDRAIEG | Prothrombin | Serum | 638.78 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9897 | KNPLPSKETIEQEKQAGES | Thymosin beta-4-like protein 1 | Serum | 705.03 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9898 | KTETQEKNPLPSKETIEQEKQAGES | Thymosin beta-4-like protein 1 | Serum | 708.12 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9899 | TAVVTNPKE | Transthyretin | Serum | 479.76 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9900 | TTAVVTNPKE | Transthyretin | Serum | 530.27 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9901 | STTAVVTNPKE | Transthyretin | Serum | 573.79 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9902 | YSTTAVVTNPKE | Transthyretin | Serum | 655.31 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9903 | SYSTTAVVTNPKE | Transthyretin | Serum | 698.82 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9904 | YSYSTTAVVTNPKE | Transthyretin | Serum | 780.35 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9905 | EHAEVVFTANDSGPR | Transthyretin | Serum | 543.59 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9906 | SPYSYSTTAVVTNPKE | Transthyretin | Serum | 872.4 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9907 | HEHAEVVFTANDSGPR | Transthyretin | Serum | 589.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9908 | LLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 657.34 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9909 | YTIAALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 830.43 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9910 | RYTIAALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 882.46 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9911 | DSGPRRYTIAALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 790.14 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9912 | FTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 898.48 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9913 | SGPRRYTIAALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 761.42 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9914 | EKTPKDESANQEEPEARVPAQ | Vasodilator-stimulated phosphoprotein | Serum | 785.04 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9915 | SEIDAELKNIL | Vitamin D-binding protein | Serum | 622.82 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9916 | EEEAPAPEVGASKPEGI | Vitronectin | Serum | 855.41 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9917 | PGPLTLKEVEELEQ | Zyxin | Serum | 791.43 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |